PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008227297.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family MYB
Protein Properties Length: 336aa    MW: 37149.3 Da    PI: 5.1986
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008227297.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.22.1e-142673148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l  +    G g+W+ +ar  g+ R++k+c++rw +yl
   XP_008227297.1 26 KGLWSPEEDDKLMSYMINNGQGCWSDVARNAGLQRCGKSCRLRWINYL 73
                     678*******************************************97 PP

2Myb_DNA-binding52.31.3e-1679122146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+el+++++ +lG++ W+ Ia++++ gRt++++k++w++
   XP_008227297.1  79 RGAFSPQEEELIIHLHSLLGNR-WSQIAARLP-GRTDNEIKNFWNS 122
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.1272173IPR017930Myb domain
SuperFamilySSF466891.8E-2724120IPR009057Homeodomain-like
SMARTSM007177.1E-102575IPR001005SANT/Myb domain
PfamPF002493.5E-132673IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-222780IPR009057Homeodomain-like
CDDcd001671.32E-82973No hitNo description
PROSITE profilePS5129425.91874128IPR017930Myb domain
SMARTSM007174.9E-1678126IPR001005SANT/Myb domain
PfamPF002492.1E-1579122IPR001005SANT/Myb domain
CDDcd001671.03E-1181121No hitNo description
Gene3DG3DSA:1.10.10.604.1E-2681129IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MRKPEPSAAA AKNNNNNSNN TSKLRKGLWS PEEDDKLMSY MINNGQGCWS DVARNAGLQR  60
CGKSCRLRWI NYLRPDLKRG AFSPQEEELI IHLHSLLGNR WSQIAARLPG RTDNEIKNFW  120
NSTIKKRLKN LSSSNASPNT SDSSSEPKDH HAMLAGGFIP GQEHGMMPLY MDSSPSLMQS  180
TVLNHMFDPL PMLDHASLTL PGGAGGYYNA TPCTTQINGV GGDCCFGDNG VFGVGGGVDI  240
GVEGEIFVPA LECVSTEDQN LKTEPIYDHR NTTNGNYYNN INSITNTNYN NNIKVENIGV  300
GNYYDDQEEL TMGEWDLEDL MKDVSSASFP FLDHRS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27241285108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008227297.10.0PREDICTED: transcription factor MYB46
SwissprotQ9LXV22e-74MYB46_ARATH; Transcription factor MYB46
TrEMBLM5WGP81e-168M5WGP8_PRUPE; Uncharacterized protein
STRINGGLYMA12G06180.21e-119(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.16e-61myb domain protein 83